PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 789aa    MW: 85539 Da    PI: 5.6655
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2385genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.93.7e-3090174187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++qe+laL+++r++m+ ++r++  k+plWe+vs+k++e g++rs+k+C+ek+en++k+yk++ke++ +r++++s  +++f+qlea
  Gh_D12G2385  90 RWPRQETLALLKIRSDMDATFRDATVKGPLWEDVSRKLAELGYKRSAKKCREKFENVHKYYKRTKETRAGRQDGKS--YKFFSQLEA 174
                  8*********************************************************************866665..*******85 PP

2trihelix109.91.6e-34529614187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k evlaLi++r+ +e+r++++  k+plWee+s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf+ql+a
  Gh_D12G2385 529 RWPKTEVLALINLRSGLESRYQEAGPKGPLWEEISAGMSRLGYKRSAKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHQLDA 614
                  8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004887149IPR001005SANT/Myb domain
CDDcd122033.35E-2889154No hitNo description
PROSITE profilePS500906.66789147IPR017877Myb-like domain
PfamPF138377.4E-2189175No hitNo description
SMARTSM007170.035526588IPR001005SANT/Myb domain
CDDcd122035.86E-32528593No hitNo description
PfamPF138371.5E-23528615No hitNo description
PROSITE profilePS500906.76528586IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MQQEGGGGGG GGGQQSQYGE MTTGPPTTGA VSEASEQLVE AASPISSRPP AGNLDEFMRL  60
ASVGGGDELG LGDRHGSGGG GGAGVASGNR WPRQETLALL KIRSDMDATF RDATVKGPLW  120
EDVSRKLAEL GYKRSAKKCR EKFENVHKYY KRTKETRAGR QDGKSYKFFS QLEALQTTSG  180
AAPGNVSIPV IPATVAVTAA SLDVAPVSVG IPMPISSAAR IVPPTTAVPM SSSSFLAMPG  240
SALAPVPVAV PEPATAPAPA PPAATTAAPF GISFSSNSST FSQGFDDDEE DEDEVGVGGE  300
PSSMAGTSRK RKRSSSRGGG GSSTRRMMEF FEGLMKQVMQ KQEAMQQRFL EAMEKREQDR  360
TIREEAWKRQ EMARLTREHE LMAQERAIAA SRDAAIVSFL QKITGQTIQL PTTATVIVPA  420
APPPPPPTQP TVSVVPPEVP IAPPSHQTPT LPQQKQQEQQ QTHISHHQPP PPQQQPQVVQ  480
QQQQLQHMEL VRHQQQPITT EIVMAIPEQQ VPPQETGGSG SLAEPASSRW PKTEVLALIN  540
LRSGLESRYQ EAGPKGPLWE EISAGMSRLG YKRSAKRCKE KWENINKYFK KVKESNKKRP  600
EDAKTCPYFH QLDALYRKKI LGGGTSSGSF SDHNRPDEET SRQHHDPTLS TAAPQPSQNE  660
SGATADVVTS KEGLSSHPFG EGYGGAAKKP GSTVRELMEE QREGLHHQQH HHRGQSLLVD  720
GYGRIDEPDS DIMDQEVDED DDEEDNDDDD DEELEEERKM GYKIEFQRQN SNTPNGGGNG  780
APSFFTMVQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.30650.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439901.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X1
SwissprotQ391175e-72TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D2UA280.0A0A0D2UA28_G
STRINGSb01g049740.11e-158(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62262746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.13e-56GT-2-like 1